PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 323aa    MW: 36122.8 Da    PI: 5.3949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03889.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.4e-191158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W teEde+lv +v+++G+g+W++++++ g+ R++k+c++rw +yl
       KHN03889.1 11 KGPWKTEEDEKLVAYVERHGPGNWRSVPAKAGLQRCGKSCRLRWINYL 58
                     79********************************************97 PP

2Myb_DNA-binding50.35.6e-1664107146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+  +v+++ +lG++ W+ Ia++++ +Rt++++k++w++
       KHN03889.1  64 RGSFSLEEHRTIVQLHSLLGNK-WSIIAAHLP-KRTDNDIKNYWNT 107
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-25261IPR009057Homeodomain-like
PROSITE profilePS5129425.466662IPR017930Myb domain
SuperFamilySSF466892.06E-308105IPR009057Homeodomain-like
SMARTSM007173.4E-131060IPR001005SANT/Myb domain
PfamPF002497.2E-171158IPR001005SANT/Myb domain
CDDcd001671.56E-111358No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2362113IPR009057Homeodomain-like
PROSITE profilePS5129420.43363113IPR017930Myb domain
SMARTSM007171.2E-1463111IPR001005SANT/Myb domain
PfamPF002492.1E-1464107IPR001005SANT/Myb domain
CDDcd001671.57E-1066109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MPCCEKVGLN KGPWKTEEDE KLVAYVERHG PGNWRSVPAK AGLQRCGKSC RLRWINYLNP  60
NIKRGSFSLE EHRTIVQLHS LLGNKWSIIA AHLPKRTDND IKNYWNTNIK KGLIGKGLDP  120
LTYKPIKSNT FQAYGGNFLD PSIDTTNMNH VAQSESAQIE AEARESMLQF GSLPSHLPGL  180
ILSKIPTQPF PSSASLLTQR INTTYDMYAL VLATNHLDLH PPPFTDPESF PSRKLLPSVS  240
TSVGQSTDPE SSLSYDGIGY NMIDNSSSQM QMTMECYATN FEDDDVMIAL EAFGIARFEG  300
IQELFDGPTT MEDLINESFE RDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-3191112103C-Myb DNA-Binding Domain
1msf_C8e-3191112103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543953.10.0PREDICTED: transcription factor MYB34-like
TrEMBLI1LXA20.0I1LXA2_SOYBN; Uncharacterized protein
TrEMBLA0A0B2P8K00.0A0A0B2P8K0_GLYSO; Transcription factor MYB28
TrEMBLA0A0R0GI630.0A0A0R0GI63_SOYBN; Uncharacterized protein
STRINGGLYMA13G09010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3608522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-66myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]